"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7NPV9"	"{'domain_architectures': 60928, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 60928}"	"[""Methylates the ribose at the nucleotide 34 wobble position in the two leucyl isoacceptors tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). Catalyzes the methyl transfer from S-adenosyl-L-methionine to the 2'-OH of the wobble nucleotide""]"	"trmL"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001510', 'name': 'RNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008173', 'name': 'RNA methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q7NPV9_CHRVO"	"1f4922ed6291786582caadede6a092d9f64a556b"	True	False	False	154	"tRNA (cytidine(34)-2'-O)-methyltransferase"	3	"UP000001424"	"MFTVVLFQPEIPPNTGNVIRLCANTGCELHLVKPMGFPLEDAKLRRAGLDYHEYARVVVHEDWDACLRTLQGRRIFAATTKGATRHDRISYQPGDVFLFGPESRGLPQDVLAALPAQQRIRLPMRPESRSLNLSNAVAVTVFEAWRQLGFEGGV"	"unreviewed"	"{'taxId': '243365', 'scientificName': 'Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)', 'fullName': 'Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)'}"