"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7N7F0"	"{'domain_architectures': 22630, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22630}"	"['NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol']"	"nqrE"	"[{'identifier': 'GO:0016655', 'name': 'oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0022904', 'name': 'respiratory electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009276', 'name': 'Gram-negative-bacterium-type cell wall', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"NQRE_PHOLL"	"ab97e895e3c90b2580dc69b86b41d64f6f9b8e90"	True	False	False	198	"Na(+)-translocating NADH-quinone reductase subunit E"	3	"UP000002514"	"MEHFISLFVRAVFIENMALAFFLGMCTFLAVSKNVTTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVNCAIFGGVSFMAQRDYNFSESIVYGFGSGIGWMLAIVLLASIREKMKYADVPAGLKGLGITFVTTGLMALGFMSFSGVQL"	"reviewed"	"{'taxId': '243265', 'scientificName': 'Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)', 'fullName': 'Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)'}"