"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7M329"	"{'domain_architectures': 16507, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'prosite': 2, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16507}"	"[""Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8. Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8. In plasmacytoid dendritic cells, it cooperates with PLD3 or PLD4 5'->3' exonucleases to process RNA fragments and release 2',3'-cyclic guanosine monophosphate (2',3'-cGMP), a potent stimulatory ligand for TLR7. Also plays a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria. Participates as well in degradation of mitochondrion-associated cytosolic rRNAs""]"	"RNASET2"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0033897', 'name': 'ribonuclease T2 activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RNT2_PIG"	"3bfedffb93b54eb1e9564315b5abc6ab7e25cb97"	True	False	False	200	"Ribonuclease T2"	1	"UP000008227"	"HEWKKLIMVHHWPMTVCNEKNCEHPPDYWTIHGLWPDKSGECNRSWPFNPDEIKGLLPDMRLYWPDVLHSSPNHSVHFWRHEWEKHGTCAAQLDALNSQRKYFGKTLDLYKELALNSTLQKLGIKPSISYYQISDIKHALVGVYGVVPKVQCLPPKSGEKVQTLGQIELCLTRDLQLQDCPEPGLEICEDGPVFYPPPKE"	"reviewed"	"{'taxId': '9823', 'scientificName': 'Sus scrofa', 'fullName': 'Sus scrofa (Pig)'}"