"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q77ZJ9"	"{'domain_architectures': 2223, 'entries': 4, 'isoforms': 1, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2223}"	"['Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation']"	"M"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033644', 'name': 'host cell membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0055036', 'name': 'virion membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"M2_I77A9"	"e6d923ab963dc33a4b3f474023342d9fc49fd6e6"	False	False	97	"Matrix protein 2"	3	""	"MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE"	"reviewed"	"{'taxId': '217831', 'scientificName': 'Influenza A virus (strain A/Equine/New Market/1/1977 H7N7)', 'fullName': 'Influenza A virus (strain A/Equine/New Market/1/1977 H7N7)'}"
