"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q76RH3"	"{'domain_architectures': 54, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'hamap': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 54}"	"['Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery']"	"ORF38"	""	"Q76RH3_HHV8"	"59214c26865896e952d338cdbfa109dac08eebee"	False	False	False	61	"Cytoplasmic envelopment protein 3"	3	""	"MGFLLSICKRPSQPVDVDGEPLDVVVDYDPIRVSEKGMLLEQSQSPYPALKKKKKNKEAIY"	"unreviewed"	"{'taxId': '37296', 'scientificName': 'Human herpesvirus 8', 'fullName': 'Human herpesvirus 8 (HHV-8)'}"
