"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q75AR6"	"{'domain_architectures': 4991, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4991}"	"['Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane']"	"AGOS_ADL146W"	"[{'identifier': 'GO:0042407', 'name': 'cristae formation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0061617', 'name': 'MICOS complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"Q75AR6_EREGS"	"d042619ba39886ae04423eab27510f77b2e65e56"	True	False	False	222	"MICOS complex subunit"	4	"UP000000591"	"MARVDFYRECDIVAEGVVPPQTGAIVSSDAYEASAKNVAEVLGQNQLLEGISVRTPGWLVNFFQKSRTVVTAGAERAAHQIETVSRRYYEKERRITSTVAALHSNPREELLPGFGAVAVAYFSGSVLTRKRGIVLRVCAPLALGLGAFSYFLPTTFRNTKSLCYDLEKRAFPQFVAQQDRLAAGTKRAVCGTVHTTVSAYNATHRACRKVTKVFRDWTGLNL"	"unreviewed"	"{'taxId': '284811', 'scientificName': 'Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)', 'fullName': 'Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast)'}"
