"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q72R01"	"{'domain_architectures': 75281, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 75281}"	"['Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins']"	"clpP2"	"[{'identifier': 'GO:0004176', 'name': 'ATP-dependent peptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004252', 'name': 'serine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"CLPP2_LEPIC"	"8b36e1ef7ed4f1caec784c71a0c390b681925f43"	True	False	False	197	"ATP-dependent Clp protease proteolytic subunit 2"	3	""	"MPETEKIAEVFEELTGSKISKNFLDHRKIFLWGPVTDESSKDLVGKLLYLEMKDPGKKITFYINSPGGVVTSGMTVFDTIKMISSPVHTVCMGMAASMGSVLLAAGTKGERSIWPNGKVMIHQPSIGGQIVAPATDLKIHAEEILKTKTKLNQILADACGHPISKLEEDTDRDYYMDAEEAIKYGIVDKLATKIDFN"	"reviewed"	"{'taxId': '267671', 'scientificName': 'Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)', 'fullName': 'Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)'}"
