"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6P2S0"	"{'domain_architectures': 3655, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3655}"	"['Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding']"	"SRP9"	"[{'identifier': 'GO:0008312', 'name': '7S RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006614', 'name': 'SRP-dependent cotranslational protein targeting to membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0048500', 'name': 'signal recognition particle', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0045900', 'name': 'negative regulation of translational elongation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q6P2S0_HUMAN"	"1c00bc3eca68460c0043c75d0d0dc9502af442c6"	True	False	False	49	"Signal recognition particle 9 kDa protein"	1	"UP000005640"	"MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVDH"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"
