"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6NH03"	"{'domain_architectures': 34052, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 34052}"	"['Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate']"	"aroK"	""	"AROK_CORDI"	"73ffdc8dadfe2f2e23806a5420ad0e38b817d41e"	True	False	False	173	"Shikimate kinase"	3	"UP000002198"	"MSGRVRPIVVLVGPPGSGKTTIGRRLANALNTSVVDSDVLIEQLQGKPCGVVFAELGEPNFRDLEAEVIDFALTTAGVVSLGGGAVTTESVRQKLRAQIVVWVDVSAAEGVRRTAVENSRPLLDTTNPLERYSELLAQRRDFYKEVADYRAHTDGRSPQQIVADILGFLETLR"	"reviewed"	"{'taxId': '257309', 'scientificName': 'Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)', 'fullName': 'Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)'}"