"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6KZK7"	"{'domain_architectures': 40137, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 40137}"	"['Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate']"	"lipB2"	"[{'identifier': 'GO:0036211', 'name': 'protein modification process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033819', 'name': 'lipoyl(octanoyl) transferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009249', 'name': 'protein lipoylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"LIPB2_PICTO"	"c31ed954e7a430bfa6effa7d5abb1606810f26b8"	True	False	False	245	"Probable octanoyltransferase 2"	3	""	"MKAGHKTIDKSYMHVSLIFYSIIIFMNMPDFIIFETPMEYKPVLYFQRKLVDLRNNDKIDDTFIFLEHNDVYTAGVHYRGNDDIIRVERGGYETYHGPGQLVVYFIINLRERKMNALDLIKKIQNSVVNTLKYYNIESYPMLNEKTGVWHEDRKICSIGIAIRGFSTFHGMALNVNTDLSKFNRIMPCNFSPDIMTSMERISGRPFNINSVRERLIQSIEKEFDIKEKNIYKNVDLVGYGNGLLP"	"reviewed"	"{'taxId': '1122961', 'scientificName': 'Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)', 'fullName': 'Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)'}"
