"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6ENU9"	"{'domain_architectures': 13683, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13683}"	"['One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface and is required for correct PSII assembly and/or dimerization']"	"psbL"	"[{'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009523', 'name': 'photosystem II', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009539', 'name': 'photosystem II reaction center', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PSBL_SACOF"	"73ec356d7f7955aae534543b5bba431cbbdb49e9"	True	False	False	38	"Photosystem II reaction center protein L"	3	""	"MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN"	"reviewed"	"{'taxId': '4547', 'scientificName': 'Saccharum officinarum', 'fullName': 'Saccharum officinarum (Sugarcane)'}"
