"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6DI06"	"{'domain_architectures': 17178, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17178}"	"['Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity)']"	"timm10"	""	"TIM10_DANRE"	"f9178374a5901be0d54a7f9dfe55ffbddb0efa3a"	True	False	False	88	"Mitochondrial import inner membrane translocase subunit Tim10"	3	"UP000000437"	"MDPMKAQQLAAELEVEMMADMYNRMTNACHRKCVPPHYKEAELSKGEAVCLDRCVAKYLDLHERLGRKLTELSVQDEEVMRKAAAGTG"	"reviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"
