"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6CQX4"	"{'domain_architectures': 10709, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10709}"	"['Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import (By similarity)']"	"NTF2"	"[{'identifier': 'GO:0006913', 'name': 'nucleocytoplasmic transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"NTF2_KLULA"	"afbad8af13c47d1f38e411b81ab56acd5f1b4e87"	True	False	False	125	"Nuclear transport factor 2"	3	"UP000000598"	"MSVDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETTQLQGAKDIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLMPEGSSYYVYNDIFRLNYSA"	"reviewed"	"{'taxId': '284590', 'scientificName': 'Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)', 'fullName': 'Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast)'}"