"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q66SC4"	"{'domain_architectures': 51372, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 51372}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I']"	"nad6"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q66SC4_BIPCA"	"96cfd4c69773af29d548fde0c6c747d9cca5615a"	True	False	False	171	"NADH-ubiquinone oxidoreductase chain 6"	3	""	"MTYVVYFLGAALLLSVVGVAINPAPYFAAGALALAALFGGAILAWCGGLFLPVVLLLIYLGGMLVVFAYAIALVPGETRGAYGHWRAWVVVVGAVFIMLCLVEFAFGVLDWGGCWVGSYGVVGVKVDLCGVGGLYTFGMWWLLLCGLCLFVCLFVVLGLSFGGSRGGVRPF"	"unreviewed"	"{'taxId': '273521', 'scientificName': 'Bipes canaliculatus', 'fullName': 'Bipes canaliculatus (Four-toed worm lizard)'}"