"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q66KE3"	"{'domain_architectures': 45, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 2, 'smart': 2, 'cathgene3d': 2, 'ssf': 2, 'pfam': 3, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 45}"	"[""Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Cpsf4 binds RNA polymers with a preference for poly(U) (By similarity)""]"	"cpsf4"	"[{'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CPSF4_XENTR"	"09102e5af9b45a9ae2ebac9aae1439d62055ce08"	True	False	False	269	"Cleavage and polyadenylation specificity factor subunit 4"	2	"UP000008143"	"MQELIACVDHIRFDLELAVEQQLGAQPLPFPGMDKSGAAVCEFFLKSACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCIEGPNCKFMHPRFELPMGTTEQPPLPQQTQTQQKQNNNQVLQRSSSLIQLTSQNSPVSQQRSPQTIGVMQSQSGNQGNRGPRPLDQVTCYKCGEKGHYANRCTKGHLAFLSGQ"	"reviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"
