"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q66D52"	"{'domain_architectures': 28426, 'entries': 19, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 1, 'profile': 1, 'pfam': 2, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 28426}"	"['Repressor involved in the biosynthesis of the osmoprotectant glycine betaine. It represses transcription of the choline transporter BetT and the genes of BetAB involved in the synthesis of glycine betaine (By similarity)']"	"betI"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"BETI_YERPS"	"66725821d7df97a42b393f54e0e54b7da3bfed7f"	True	False	False	198	"HTH-type transcriptional regulator BetI"	3	""	"MPKVGMQPIRRQQLIEATMAAVNEVGMHEASIAQIAKRAGVSNGIISHYFRDKNGLLEATMRYLIRHLGEAVKQHLAALSVNDPRARLRAIAEGNFDDSQINSAAMKTWLAFWASSMHSPQLYRLQQVNNRRLYSNLCAEFKRCLPREQAQLAAKGMAGLIDGLWLRSALSGEHFNRQEALLIIHNYIEQQLNIKYKC"	"reviewed"	"{'taxId': '273123', 'scientificName': 'Yersinia pseudotuberculosis serotype I (strain IP32953)', 'fullName': 'Yersinia pseudotuberculosis serotype I (strain IP32953)'}"