"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q664S7"	"{'domain_architectures': 31176, 'entries': 22, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cdd': 1, 'cathgene3d': 2, 'pfam': 2, 'profile': 1, 'smart': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 9}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 31176}"	"['Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation']"	"rpsC"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RS3_YERPS"	"5cb1e9a9ec1b7bb984d56f071ef67f2bd14a35bd"	True	False	False	232	"Small ribosomal subunit protein uS3"	3	""	"MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRKGRK"	"reviewed"	"{'taxId': '273123', 'scientificName': 'Yersinia pseudotuberculosis serotype I (strain IP32953)', 'fullName': 'Yersinia pseudotuberculosis serotype I (strain IP32953)'}"
