"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q65956"	"{'domain_architectures': 481, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'hamap': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 481}"	"['Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP']"	"DBP"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"DNB2_ADECC"	"20cc6b08977d3233a2d3b3e39a23b810da584ced"	False	False	False	454	"DNA-binding protein"	3	""	"MSHKKVVAISESSSDEEVPVAPPTAPPKKRQRKAVEEPRGHQAMVEIARQATAALKARGDPGSIIVQTFCDQTVDVDKEGNVIFTPAKQKSICNKSGSPLASVASKIFKASEHKWQSAMEFALKVLNAYQVDHSKLTLLPDEGTLECFKKAVQAYITTSKMHVTYTFTNQKTFLHVAGRLLLDFVIKAAELAPGVNPSGCVVWQHGCQSSLMCLHGSPMIQKEQLVEMDVNSENAQRALKENPEKTKIVSNRWGRNVVQFKNEDAFCCSMDVNMSGGNFSGASCGMFYTDGPKAIMAFQQIMAFLKACYPSMPNAESHLLMPLKCECNWNSSLPLLGRQTCKITPFSLASASHIDKSEVDDQKMLATLNNPAMLVFQCCNPVYRNSKAAPQKNCDFKISSVDLVSCLQIAKQIWLSTVGERPPVKFPEFHWSDEHRYQTTILPQGQHDDDLVLF"	"reviewed"	"{'taxId': '69150', 'scientificName': 'Canine adenovirus serotype 1 (strain CLL)', 'fullName': 'Canine adenovirus serotype 1 (strain CLL) (CAdV-1)'}"
