General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q656T5",
        "id": "Q656T5_ORYSJ",
        "source_organism": {
            "taxId": "39947",
            "scientificName": "Oryza sativa subsp. japonica",
            "fullName": "Oryza sativa subsp. japonica (Rice)"
        },
        "name": "Os01g0574600 protein",
        "description": [
            "Catalyzes the NADPH-dependent reduction of glyoxylate to glycolate as well as succinic semialdehyde (SSA) to gamma-hydroxybutyrate in vitro. May function in redox homeostasis and play a role in oxidative stress tolerance by detoxifying glyoxylate and SSA generated in glycolate metabolism and GABA metabolism, respectively"
        ],
        "length": 341,
        "sequence": "MAAMAAASLLCARAAAAAPTLRLRGGGRGARLVFSCSASSSSPSGEGGFSGKVGFLGLGIMGAPMASNLINAGCDVTVWNRTRSKCDPLLSLGAKYEPSPADVASSCDVTFAMLADPESAVEVACGANGAAQGMAPGKGYVDVSTVDAATSKLIGKHITSTGASFLEAPVSGSKKPAEDGLLIFLTAGDESLYNRVASLLDVMGKSRFFLGDVGKGADMKLVVNMVMGSMMVSFSEGLLLSEKVGLDPNTLVEVISQGAISAPMFSLKGPSMVKAAYPTAFPLKHQQKDLRLALALAESVSQSIPTVAAANELYKVAKSLGLADQDFSAVIEALKAKEQSK",
        "proteome": "UP000059680",
        "gene": "Os01g0574600",
        "go_terms": [
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "9debebb0457f7929d9266d339bd4a1253a6b98fd",
        "counters": {
            "domain_architectures": 45991,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 45991
        }
    }
}