GET /interpro/api/protein/UniProt/Q656T5/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q656T5",
"id": "Q656T5_ORYSJ",
"source_organism": {
"taxId": "39947",
"scientificName": "Oryza sativa subsp. japonica",
"fullName": "Oryza sativa subsp. japonica (Rice)"
},
"name": "Os01g0574600 protein",
"description": [
"Catalyzes the NADPH-dependent reduction of glyoxylate to glycolate as well as succinic semialdehyde (SSA) to gamma-hydroxybutyrate in vitro. May function in redox homeostasis and play a role in oxidative stress tolerance by detoxifying glyoxylate and SSA generated in glycolate metabolism and GABA metabolism, respectively"
],
"length": 341,
"sequence": "MAAMAAASLLCARAAAAAPTLRLRGGGRGARLVFSCSASSSSPSGEGGFSGKVGFLGLGIMGAPMASNLINAGCDVTVWNRTRSKCDPLLSLGAKYEPSPADVASSCDVTFAMLADPESAVEVACGANGAAQGMAPGKGYVDVSTVDAATSKLIGKHITSTGASFLEAPVSGSKKPAEDGLLIFLTAGDESLYNRVASLLDVMGKSRFFLGDVGKGADMKLVVNMVMGSMMVSFSEGLLLSEKVGLDPNTLVEVISQGAISAPMFSLKGPSMVKAAYPTAFPLKHQQKDLRLALALAESVSQSIPTVAAANELYKVAKSLGLADQDFSAVIEALKAKEQSK",
"proteome": "UP000059680",
"gene": "Os01g0574600",
"go_terms": [
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "9debebb0457f7929d9266d339bd4a1253a6b98fd",
"counters": {
"domain_architectures": 45991,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 45991
}
}
}