"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q64LH0"	"{'domain_architectures': 10196, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'prosite': 1, 'prints': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10196}"	"['Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity)']"	"D03"	"[{'identifier': 'GO:0003779', 'name': 'actin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"PROF3_AMBAR"	"9a5573d0ebb5c532b4444f54b2266218d455b937"	True	False	False	133	"Profilin-3"	1	""	"MSWQAYVDEHLMCDIEGTGHHLTSAAILGHDGTVWAQSSNFPQFKPEEMKGIITEFDQAGTLAPTGMFIAGAKYMVLQGEQGAVIRGKKGAGGICIKKTGQALVMGIYDEPVAPGQCNMVVERLGDYLIDQGM"	"reviewed"	"{'taxId': '4212', 'scientificName': 'Ambrosia artemisiifolia', 'fullName': 'Ambrosia artemisiifolia (Common ragweed)'}"