"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q62GK7"	"{'domain_architectures': 42768, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 42768}"	"['One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome']"	"rplW"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL23_BURMA"	"118b0ee2cd3e298b8d4868fd2abf4aa4160aa12b"	True	False	False	104	"Large ribosomal subunit protein uL23"	3	"UP000006693"	"MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQEVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK"	"reviewed"	"{'taxId': '243160', 'scientificName': 'Burkholderia mallei (strain ATCC 23344)', 'fullName': 'Burkholderia mallei (strain ATCC 23344)'}"
