"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q60648"	"{'domain_architectures': 12194, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12194}"	"['Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity. Has cholesterol transfer activity (By similarity)']"	"Gm2a"	"[{'identifier': 'GO:0008047', 'name': 'enzyme activator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006689', 'name': 'ganglioside catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SAP3_MOUSE"	"f987f23ac86eaabd183ac60f083a5628166b7889"	True	False	False	193	"Ganglioside GM2 activator"	1	"UP000000589"	"MHRLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"