"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5R7T1"	"{'domain_architectures': 13240, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 2, 'pfam': 2, 'panther': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13240}"	"['Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Displays no strong substrate specificity with respect to the carboxylic acid moiety of Acyl-CoAs. Hydrolyzes medium length (C2 to C20) straight-chain, saturated and unsaturated acyl-CoAS but is inactive towards substrates with longer aliphatic chains. Moreover, it catalyzes the hydrolysis of CoA esters of bile acids, such as choloyl-CoA and chenodeoxycholoyl-CoA and competes with bile acid CoA:amino acid N-acyltransferase (BAAT). Is also able to hydrolyze CoA esters of dicarboxylic acids. It is involved in the metabolic regulation of peroxisome proliferation']"	"DKFZp459N2124"	"[{'identifier': 'GO:0047617', 'name': 'fatty acyl-CoA hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006637', 'name': 'acyl-CoA metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q5R7T1_PONAB"	"fd1a9168905e51b62daba36d9e70782041295dfb"	True	False	True	281	"Acyl-coenzyme A thioesterase 8"	2	""	"MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYQVERTRTGSSFLVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAG"	"unreviewed"	"{'taxId': '9601', 'scientificName': 'Pongo abelii', 'fullName': 'Pongo abelii (Sumatran orangutan)'}"