"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5NPY2"	"{'domain_architectures': 19168, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'ncbifam': 3, 'pfam': 1, 'hamap': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 19168}"	"['Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA']"	"accA"	"[{'identifier': 'GO:0016874', 'name': 'ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003989', 'name': 'acetyl-CoA carboxylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016743', 'name': 'carboxyl- or carbamoyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006633', 'name': 'fatty acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009317', 'name': 'acetyl-CoA carboxylase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ACCA_ZYMMO"	"c956295bae978f11e0d2fa3dea16a9cc58d6b9bf"	True	False	False	313	"Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha"	3	"UP000001173"	"MVSYLDFEKPVAELQTRIAELRKATSDEMDLDREISDLEVKVQKLLRDTYAHLTPWQKTQVARHPERPHFHDYISALCEEFIPLAGDRLFGEDEAIIGGLARIDGQRVMIIGQEKGNDTASRLKHNFGMARPEGYRKAIRLMKLADRFGLPVITLVDTSGAFPGIDAEERGQAEAIARSTETCLSLGVPLISVIVGEGGSGGAIAIAAANRLLMFEHAVYSVISPEGCASILWRDAGKASDAATAMKLTATDLYGLGIVDRIVLEPVGGAHRDPKTAIDALKMALLQELAFLKPMDRDALRSMRRKKFLDIGG"	"reviewed"	"{'taxId': '264203', 'scientificName': 'Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)', 'fullName': 'Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)'}"