"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5G7H9"	"{'domain_architectures': 20649, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 20649}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I']"	"mt-nd6"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042981', 'name': 'regulation of apoptotic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q5G7H9_XENTR"	"96cfd4c69773af29d548fde0c6c747d9cca5615a"	True	False	172	"NADH-ubiquinone oxidoreductase chain 6"	3	"UP000008143"	"MIYMVSFFMVGLVLGLVAVASNPSPYYAALGLVVAAGAGCWVIVGLGSSFLSLVLFLIYLGGMLVVFAYSAALTAEPYPEAWGSWSVVGYVVAYMVGVVTWYVVEGGVEEDGVVGLAGLEGYVVRGDWVGVSLMYSWGGWMLFVGGWVLLLTLFVVFELSRGHYSGSLRALE"	"unreviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"