"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q589A4"	"{'domain_architectures': 57558, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pirsf': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 57558}"	"['One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit']"	"rps7"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RR7_SILLA"	"b38a96b66a03eafcff49a4d98ca22b5cde0cd722"	True	False	False	155	"Small ribosomal subunit protein uS7c"	3	""	"MSRRGTVEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGAARKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR"	"reviewed"	"{'taxId': '37657', 'scientificName': 'Silene latifolia', 'fullName': 'Silene latifolia (White campion)'}"