"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q568Z4"	"{'domain_architectures': 3633, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pirsf': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3633}"	"['Essential component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity). Essential for the SPC catalytic activity, possibly by stabilizing and positioning the active center of the complex close to the lumenal surface (By similarity)']"	"Spcs3"	"[{'identifier': 'GO:0006465', 'name': 'signal peptide processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005787', 'name': 'signal peptidase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"SPCS3_RAT"	"464925cc090c436e913eaf35f756cd3f0cc488d0"	True	False	False	180	"Signal peptidase complex subunit 3"	2	"UP000002494"	"MNTLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKILLRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF"	"reviewed"	"{'taxId': '10116', 'scientificName': 'Rattus norvegicus', 'fullName': 'Rattus norvegicus (Rat)'}"
