"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q52KL1"	"{'domain_architectures': 1092, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1092}"	"[""Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate (By similarity). Preferentially hydrolyzes unsaturated long-chain acyl-CoA substrates in the endoplasmic reticulum (ER) lumen (By similarity). This catalytic activity is required for maintaining ER structure and for lipid droplets (LDs) biogenesis, which are lipid storage organelles involved in maintaining lipid and energy homeostasis (By similarity) (PubMed:18160536). Required for lipid droplet accumulation in liver and intestine during embryogenesis (PubMed:18160536). May directly bind to diacylglycerol (DAGs) and triacylglycerol, which is also important for LD biogenesis (By similarity). May support directional budding of nacent LDs from the ER into the cytosol by reducing DAG levels at sites of LD formation (By similarity). May play a role in the regulation of cell morphology, ER morphology and cytoskeletal organization (By similarity)""]"	"fitm2"	"[{'identifier': 'GO:0019915', 'name': 'lipid storage', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0034389', 'name': 'lipid droplet organization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0010945', 'name': 'coenzyme A diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005789', 'name': 'endoplasmic reticulum membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"FITM2_DANRE"	"39e170798c152dc3e52aef5a3a5958d19ab584ca"	True	False	False	252	"Acyl-coenzyme A diphosphatase FITM2"	2	"UP000000437"	"MAAAVAGSLVDKLVCLWRQPYTRIYLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNFYIKSHMFALRRLTSLLVATLVWYICTETFFYIEDITGSCYESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEEMVPMLHIQPAYRNPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYVKLFSPGLPPQPKQHT"	"reviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"
