"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4WR24"	"{'domain_architectures': 40274, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 40274}"	"['3-ketosteroid 1-dehydrogenase; part of the gene cluster that mediates the biosynthesis of helvolic acid, an antibacterial nortriterpenoid (PubMed:19216560, PubMed:19415934, PubMed:29158519). Protostadienol synthase helA cyclizes (3S)-oxidosqualene to (17Z)-protosta-17(20),24-dien-3-beta-ol (protostadienol) (PubMed:19216560, PubMed:19415934, PubMed:29158519). The synthesis of protostadienol is followed by several steps of monooxygenation, dehydrogenation, and acyl transfer to yield the final helvolic acid (PubMed:19216560). Following the cyclization to the tetracyclic protostadienol by helA, cytochrome P450 monooxygenases helB1-mediated and helB2-mediated oxidation at C-4 and C-16, acyltransferase helD2-dependent acetylation of 16-OH, oxidation of C-21 by cytochrome P450 monooxygenase helB4, and short chain dehydrogenase helC-dependent oxidative decarboxylation yield the fusidane skeleton (PubMed:29158519). This intermediate is further modified in three additional steps mediated by the cytochrome P450 monooxygenase helB3, the acyltransferase helD1, and the 3-ketosteroid 1-dehydrogenase helE to give helvolic acid (PubMed:19216560, PubMed:19415934, PubMed:29158519). Compared with the late stages in the biosynthesis of helvolic acid, enzymes involved in the early stage modifications act in a relatively strict order (PubMed:29158519). The hydroxylation of C-16 by helB1 and subsequent acetylation by helD2 should occur before the helB3-mediated oxidation of C-21 (PubMed:29158519). C-4 demethylation in fusidane-type antibiotics proceeds in an unusual manner though it is also achieved by oxidative decarboxylation (PubMed:19415934, PubMed:29158519). The methyl group at C-4 beta position is oxidized by helB1 and subsequently removed by the short chain dehydrogenase helC (PubMed:19415934, PubMed:29158519)']"	"helE"	""	"HELE_ASPFU"	"f8c050f2bae5a7641bef04066a98503b1963e30d"	True	False	False	596	"3-ketosteroid 1-dehydrogenase helE"	1	"UP000002530"	"MAARQLRRLSLPTHLPLPIRPHVRHLGTAQTNCHRFDHETDILIVGSGAAGLTAALRSHFHGLSSLVIEKDAQIGGTSAYSGGGLWIPNNPLAVEAGIIDTPEQAMTYLISVIDADTAEDTDVRRASSPPRKRAFLTHGPHMVSFLRDRGFAFRLSPGCPDYYPQAHGALPTGGRSIEPDVFDARLLGLGEKWTEAIRQRPGRSLPLFTYEASSVTRMGASWRDVGTVLRVLLRGIYLSRVRGQIPVTMGKSLVAQLLWLHMQLDQGPVLTDTALRQLIATPEGVILGARVATPDGERSIRARCGVLLCAGGFAHNQGLRERYGPVPANAEWTSAARGDNGDAIVAGVRVGAATALMDEAWWGPTLRDPVRGMYYFALQERARPFGVIVDSSGKRFMNEAEPYTDAGHHQYAQKAVPAWFVFDWNHRKRYAVGSLMPRQQPPAQALDAGYIHRADTIAELARQIGVNEKGLEGTLARFNEMADCGVDSDFARGESAFDNYFGDPTVRPNPNLGAVRTPPFYAIPLVPGDLGTKGGLLTDEHARVIREDGTPVQGLYAAGNTTASVMGRTYPGAGATLGPAMTFAFIAIDHIASEHV"	"reviewed"	"{'taxId': '330879', 'scientificName': 'Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)', 'fullName': 'Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)'}"