"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q4QKZ4"	"{'domain_architectures': 57966, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 57966}"	"['Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism']"	"ssb3"	"[{'identifier': 'GO:0003697', 'name': 'single-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q4QKZ4_HAEI8"	"f1fb2be8363e3a291867f69be613915a57077a1b"	True	False	False	144	"Single-stranded DNA-binding protein"	3	""	"MARNTNTVILVGHLGSDPEIRQFQNGGQIATFNLAIGDDYRDKQGNTVKRTHWIPIVVHGNSADVARQYLQKGSKICVTGKLVQESWQDQNGNNRTALKVATQSFEMLDSKANNETQQPSKDKEKPDPLSAAAEQDGFDDDIPF"	"unreviewed"	"{'taxId': '281310', 'scientificName': 'Haemophilus influenzae (strain 86-028NP)', 'fullName': 'Haemophilus influenzae (strain 86-028NP)'}"
