"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q48CC6"	"{'domain_architectures': 250306, 'entries': 17, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 3, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 250306}"	"[""Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage""]"	"rppH"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RPPH_PSE14"	"752b3b6d9807717ea1f029db1420a2538cb188ca"	True	False	False	159	"RNA pyrophosphohydrolase"	3	""	"MIDPDGFRPNVGIILTNDAGQVLWARRINQDAWQFPQGGINPQETPEDALYRELNEEVGLERHDVQILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRLISNEQRVRMDLTGKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLSRD"	"reviewed"	"{'taxId': '264730', 'scientificName': 'Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)', 'fullName': 'Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)'}"