"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q3M9V6"	"{'domain_architectures': 49652, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 49652}"	"['F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation', 'Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits']"	"atpE"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0033177', 'name': 'proton-transporting two-sector ATPase complex, proton-transporting domain', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015986', 'name': 'proton motive force-driven ATP synthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045259', 'name': 'proton-transporting ATP synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ATPL_TRIV2"	"d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98"	True	False	False	81	"ATP synthase subunit c"	3	""	"MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFANPFA"	"reviewed"	"{'taxId': '240292', 'scientificName': 'Trichormus variabilis (strain ATCC 29413 / PCC 7937)', 'fullName': 'Trichormus variabilis (strain ATCC 29413 / PCC 7937)'}"
