"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q39IG9"	"{'domain_architectures': 89113, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'panther': 1, 'sfld': 3, 'pfam': 1, 'ncbifam': 3, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 89113}"	"[""Specifically catalyzes the dephosphorylation of 2-phosphoglycolate. Is involved in the dissimilation of the intracellular 2-phosphoglycolate formed during the DNA repair of 3'-phosphoglycolate ends, a major class of DNA lesions induced by oxidative stress""]"	"Bcep18194_A4150"	"[{'identifier': 'GO:0008967', 'name': 'phosphoglycolate phosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005975', 'name': 'carbohydrate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q39IG9_BURL3"	"7c618a5a1b4907fd1b81ed0bddc341d92e965caa"	True	False	False	238	"phosphoglycolate phosphatase"	3	"UP000002705"	"MTTPLSTARAALDEPRLLHCDAVLFDLDGTLADTAPDLAAAVNKMQRVRDLPETPLDVLRPLASAGARGLLGGAFGIDPQTPGYEAMRDEFLANYATDLCVHTTLFPGIGDVLDELDARGVRWGIVTNKAMRLTAPLVDLLGLAPRAACVVGGDTTPHPKPHPAPLLHAADQLTLAPARIVYVGDDLRDIQAGSAAGMATVAAAYGYCGDGAAPSDWQAQHLVDTTQQLRELLRDVGL"	"unreviewed"	"{'taxId': '482957', 'scientificName': 'Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)', 'fullName': 'Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)'}"