"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q36986"	"{'domain_architectures': 79589, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 79589}"	"['Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane']"	"atp6"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015986', 'name': 'proton motive force-driven ATP synthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045259', 'name': 'proton-transporting ATP synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"Q36986_ORYSA"	"acaa664a20e87c3445188e8a4619f81f602dd2b5"	True	False	False	336	"ATP synthase subunit a"	3	""	"MNFDHNHVVIMGLNQRDSIWKLLNDYNVNSLKRRRQAEIDAFFEPFERAQYRFNNWQNGIELLDGAEWRNGDIVIPGGGGPVISSPLDQFFIDPLFGLDMGNFYLSFTNESLSMAVTVVLVPSLFGVVTKKGGGKSVPNAWQSLVELIYDFVLNLVNEQIGGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISHCFRALSSGIRLFANMMAGHSSVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAILQAHVSTISICIYLNDAINLHQNE"	"unreviewed"	"{'taxId': '4530', 'scientificName': 'Oryza sativa', 'fullName': 'Oryza sativa (Rice)'}"
