"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q322M1"	"{'domain_architectures': 202586, 'entries': 21, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'smart': 2, 'cathgene3d': 1, 'profile': 2, 'pfam': 2, 'cdd': 2, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 202586}"	"['Member of the two-component regulatory system UvrY/BarA involved in the regulation of carbon metabolism via the CsrA/CsrB regulatory system. UvrY activates the transcription of the untranslated csrB RNA and of barA, in an autoregulatory loop. Mediates the effects of CsrA on csrB RNA by BarA-dependent and BarA-independent mechanisms']"	"uvrY"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000976', 'name': 'transcription cis-regulatory region binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Q322M1_SHIBS"	"bf2a74b77e142e5501cae2a7fdcb5764135340de"	True	False	False	218	"Response regulator UvrY"	4	""	"MINVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRTNAVDVVLMDMSMPGIGGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDIAQQMALSQIEPEKTESPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNIHGDVELTHLAIRHGLCNAETLSSQ"	"unreviewed"	"{'taxId': '300268', 'scientificName': 'Shigella boydii serotype 4 (strain Sb227)', 'fullName': 'Shigella boydii serotype 4 (strain Sb227)'}"
