"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2PG81"	"{'domain_architectures': 9115, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'prosite': 2, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9115}"	"['Snake venom phospholipases A2 that have myotoxic, and edema-inducing activity, as well as extremely weak lipolytic activity. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides']"	""	"[{'identifier': 'GO:0004623', 'name': 'A2-type glycerophospholipase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006644', 'name': 'phospholipid metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0050482', 'name': 'arachidonate secretion', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016042', 'name': 'lipid catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"PA2B1_PROEL"	"bd0c304bac6c9e2ec8f8d5ae78d4c8944ec3a50b"	True	False	False	137	"Basic phospholipase A2 PeBP(R)-I/II"	1	""	"MRTLWIMAVLLLGVEGSLVELWKMVFQETGKEAVKNYGLYGCNCGVGKRGKPVDATDRCCFVHRCCYKKVTGCDPKKDRYSYSWENKAIVCGEKNPCLKQVCECDKAVAICLRENLGTYNKNHRVTVKFLCKAPESC"	"reviewed"	"{'taxId': '88086', 'scientificName': 'Protobothrops elegans', 'fullName': 'Protobothrops elegans (Elegant pitviper)'}"
