"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2LL65"	"{'domain_architectures': 261, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'pirsf': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 261}"	"['Attaches the circulating virion to the bacterial lipopolysaccharides which serve as receptor for the virus. Determines the phage host-range. Probably triggers with protein H the injection of the phage DNA into the host cytoplasm upon conformational changes induced by the interaction with host lipopolysaccharides']"	"G"	"[{'identifier': 'GO:0044003', 'name': 'symbiont-mediated perturbation of host process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q2LL65_9VIRU"	"7e15ddb7e9d56471961094c141a4516aa9400cff"	False	False	False	177	"Major spike protein G"	3	""	"MFQKFISKHNAPISSTQVTVTETPAATAPILGVPGLSRSTIQINVTTTAVTTHSGLCHVVRIDETNPTNHHALSVAGSLSHVSADMIAFAIRFEVADGFVPTAVPTLYDVYPIEIVNTGKAISFKDVVTIDSHPRTVGNDVYAGIMLWSNAWSATTTSGVLSVNQVNREATVLQPLK"	"unreviewed"	"{'taxId': '338138', 'scientificName': 'Enterobacteria phage NC6', 'fullName': 'Enterobacteria phage NC6'}"