"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2G493"	"{'domain_architectures': 32658, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cdd': 2, 'ssf': 2, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32658}"	"['Attaches a formyl group to the free amino group of methionyl-tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and preventing the misappropriation of this tRNA by the elongation apparatus']"	"fmt"	"[{'identifier': 'GO:0009058', 'name': 'biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004479', 'name': 'methionyl-tRNA formyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071951', 'name': 'conversion of methionyl-tRNA to N-formyl-methionyl-tRNA', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"FMT_NOVAD"	"263553189fd17f2554dea1d9646cd1ac999dfb46"	True	False	False	301	"Methionyl-tRNA formyltransferase"	3	"UP000009134"	"MRIIFMGTPDFAVPTLEALVAAGHDVVAAYSQPPRPAGRGKKLQPSPVHLAAEAHGIDVRTPVSLKGADEQTTLAAFDADVAVVAAYGLILPQAVLDAPRLGCLNVHGSLLPRWRGAAPVQRAILAGDEMTGVTIMQMERGLDTGPMLARIETPVDGKTAGDLTAELAVKGAALMVQVLADLASYPAVVQPEQGVTYAHKIDKAESRLDFTRDAVDVERQVRAFSPAPGAFFELEGERYRVLAAEVLGVAGEPGVTVDDVLAIACGTGAIRPTLIQRAGRPAMDTASLLRGRAIPGGTRLG"	"reviewed"	"{'taxId': '279238', 'scientificName': 'Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)', 'fullName': 'Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)'}"