"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2FKQ5"	"{'domain_architectures': 17631, 'entries': 28, 'isoforms': 0, 'proteomes': 0, 'sets': 5, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 4, 'pfam': 3, 'ssf': 2, 'cdd': 2, 'smart': 2, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 10}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 17631}"	"[""Plays an essential role in the initiation and regulation of chromosomal replication. ATP-DnaA binds to the origin of replication (oriC) to initiate formation of the DNA replication initiation complex once per cell cycle. Binds the DnaA box (a 9 base pair repeat at the origin) and separates the double-stranded (ds)DNA. Forms a right-handed helical filament on oriC DNA; dsDNA binds to the exterior of the filament while single-stranded (ss)DNA is stabiized in the filament's interior. The ATP-DnaA-oriC complex binds and stabilizes one strand of the AT-rich DNA unwinding element (DUE), permitting loading of DNA polymerase. After initiation quickly degrades to an ADP-DnaA complex that is not apt for DNA replication. Binds acidic phospholipids""]"	"dnaA"	"[{'identifier': 'GO:0043565', 'name': 'sequence-specific DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006270', 'name': 'DNA replication initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006275', 'name': 'regulation of DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003688', 'name': 'DNA replication origin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"DNAA_STAA3"	"af048913435faf44e3cf5dbae4bb1e79c0668ce6"	True	False	False	453	"Chromosomal replication initiator protein DnaA"	3	""	"MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV"	"reviewed"	"{'taxId': '367830', 'scientificName': 'Staphylococcus aureus (strain USA300)', 'fullName': 'Staphylococcus aureus (strain USA300)'}"
