"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q2A3N5"	"{'domain_architectures': 31239, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 31239}"	"['Hydrolyzes ribosome-free peptidyl-tRNAs (with 1 or more amino acids incorporated), which drop off the ribosome during protein synthesis, or as a result of ribosome stalling', 'Catalyzes the release of premature peptidyl moieties from peptidyl-tRNA molecules trapped in stalled 50S ribosomal subunits, and thus maintains levels of free tRNAs and 50S ribosomes']"	"pth"	"[{'identifier': 'GO:0004045', 'name': 'peptidyl-tRNA hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"PTH_FRATH"	"0acd99499c4bfe704cf6014f6a6b377ddb2d2159"	True	False	False	191	"Peptidyl-tRNA hydrolase"	3	""	"MPKIKMIVGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNTKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVAHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINYKLEPVMQKLHTK"	"reviewed"	"{'taxId': '376619', 'scientificName': 'Francisella tularensis subsp. holarctica (strain LVS)', 'fullName': 'Francisella tularensis subsp. holarctica (strain LVS)'}"