"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q27751"	"{'domain_architectures': 87265, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'smart': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 87265}"	"['Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling']"	""	"[{'identifier': 'GO:0046982', 'name': 'protein heterodimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030527', 'name': 'structural constituent of chromatin', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000786', 'name': 'nucleosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"Q27751_PSAMI"	"e204a9d55ad7bafe2e507ca80f663a0ac2378352"	True	False	False	123	"Histone H2B"	2	""	"MPAKAQAAGKKGSKKAKAPRPSGDKKRRRKRKESYGIYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFERIAAEASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTSK"	"unreviewed"	"{'taxId': '7660', 'scientificName': 'Psammechinus miliaris', 'fullName': 'Psammechinus miliaris (Green sea urchin)'}"