"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q211H1"	"{'domain_architectures': 48716, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 2, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 48716}"	"['Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome']"	"rpsK"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RS11_RHOPB"	"27014fae6cee778a178c41ffe67c2e7489fd17c3"	True	False	False	129	"Small ribosomal subunit protein uS11"	3	""	"MGKEATRVRRRERKNIASGIAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTPYAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNGCRPRKRRRV"	"reviewed"	"{'taxId': '316056', 'scientificName': 'Rhodopseudomonas palustris (strain BisB18)', 'fullName': 'Rhodopseudomonas palustris (strain BisB18)'}"