"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q167R7"	"{'domain_architectures': 4481, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 2, 'cdd': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 2, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4481}"	"['Required for both de novo synthesis of the corrin ring for the assimilation of exogenous corrinoids. Participates in the adenosylation of a variety of incomplete and complete corrinoids']"	"cobO"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008817', 'name': 'corrinoid adenosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009236', 'name': 'cobalamin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"Q167R7_ROSDO"	"2225aef9ebcf6711ad743793914a89df539206ff"	True	False	False	202	"Corrinoid adenosyltransferase"	3	"UP000007029"	"MSDENERHNAKMRKIKAARDKMMEQKTEQKGLIMVHTGKGKGKSSSGFGMIMRCISHKIPCAVVQFIKGNWDTGEKSFLRDNYADECRFFVSGEGFTWETQDRARDIAAAENGWRIAKEQILDPDIQFVLLDEINIALRYDYLNIDEVVEFLLTQKPHMTHVCLTGRNAKPELIEAADLVTEMTLVKHPFKDGVVAQKGIEF"	"unreviewed"	"{'taxId': '375451', 'scientificName': 'Roseobacter denitrificans (strain ATCC 33942 / OCh 114)', 'fullName': 'Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114))'}"