"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q12A34"	"{'domain_architectures': 30231, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'cathgene3d': 2, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 30231}"	"['Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another']"	"frr"	"[{'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RRF_POLSJ"	"2d958ca5738752922f7c19b7aa2806b876ecf5c1"	True	False	False	186	"Ribosome-recycling factor"	3	""	"MSIVEVKQNAEQKMQQSVDSFKNSLTKIRTGRANPGLLDTVHVDYYGSMVPISQVANVSLLDARTISVSPWEKGMGAKIEKAIRDSDLGLNPAAQGDLIRVPMPAMTEERRKELTKVVRAEGEHAKVAVRNLRRDANEGVKKLLKEKLVSEDDERRAQDEIQKFTDRFIAEVDKLVAGKEQDIMAV"	"reviewed"	"{'taxId': '296591', 'scientificName': 'Polaromonas sp. (strain JS666 / ATCC BAA-500)', 'fullName': 'Polaromonas sp. (strain JS666 / ATCC BAA-500)'}"