"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q0G9U5"	"{'domain_architectures': 14250, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 1, 'pfam': 2, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 14250}"	"['This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation']"	"psbE"	"[{'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009767', 'name': 'photosynthetic electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0019684', 'name': 'photosynthesis, light reaction', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009523', 'name': 'photosystem II', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009539', 'name': 'photosystem II reaction center', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PSBE_DAUCA"	"943164d70ae5b64809ddf8562891873a217eb9b7"	True	False	False	83	"Cytochrome b559 subunit alpha"	3	""	"MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQGIPLITGRFDPLEQLDEFSRSF"	"reviewed"	"{'taxId': '4039', 'scientificName': 'Daucus carota', 'fullName': 'Daucus carota (Wild carrot)'}"
