"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q08AG7"	"{'domain_architectures': 3115, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 26, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3115}"	"['Required for the recruitment and the assembly of the gamma-tubulin ring complex (gTuRC) at the centrosome (PubMed:20360068, PubMed:38609661, PubMed:39321809). The gTuRC regulates the minus-end nucleation of alpha-beta tubulin heterodimers that grow into microtubule protafilaments, a critical step in centrosome duplication and spindle formation (PubMed:38609661, PubMed:39321809)']"	"MZT1"	"[{'identifier': 'GO:0033566', 'name': 'gamma-tubulin complex localization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000931', 'name': 'gamma-tubulin ring complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"MZT1_HUMAN"	"ee14ad8459e354c910fcdd424c3bfbb5f80e7007"	True	False	False	82	"Mitotic-spindle organizing protein 1"	1	"UP000005640"	"MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS"	"reviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"