"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q035U8"	"{'domain_architectures': 34921, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'cdd': 1, 'smart': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 34921}"	"['Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors']"	"rplK"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL11_LACP3"	"24b9caf7b2077b68fd222ea791db02b9beba791e"	True	False	False	141	"Large ribosomal subunit protein uL11"	3	"UP000001651"	"MAKKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFVTKTPPAAVLLKKAAGVEHGSGEPNTKKVAKVTKDQVKEIAETKMQDLNAADVEAAMRMVEGTARSMGFEVEG"	"reviewed"	"{'taxId': '321967', 'scientificName': 'Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)', 'fullName': 'Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)'}"
