General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P9WNE6",
        "id": "FER_MYCTO",
        "source_organism": {
            "taxId": "83331",
            "scientificName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)",
            "fullName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)"
        },
        "name": "Ferredoxin",
        "description": [
            "Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions"
        ],
        "length": 114,
        "sequence": "MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP",
        "proteome": "UP000001020",
        "gene": "fdxA",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "bcb56ad2b1910b585092497591ff6188bd00ddd4",
        "counters": {
            "domain_architectures": 13418,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13418
        }
    }
}