General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P82706",
        "id": "BM01_DROME",
        "source_organism": {
            "taxId": "7227",
            "scientificName": "Drosophila melanogaster",
            "fullName": "Drosophila melanogaster (Fruit fly)"
        },
        "name": "Bomanin Short 1",
        "description": [
            "Secreted immune-induced peptide induced by Toll signaling (PubMed:25915418, PubMed:29920489, PubMed:9736738). Has a role in resistance to bacterial and fungal infections (PubMed:25915418, PubMed:29920489, PubMed:9736738). Has no activity against the fungus C.glabrata in vitro (PubMed:29920489)"
        ],
        "length": 45,
        "sequence": "MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK",
        "proteome": "UP000000803",
        "gene": "BomS1",
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "9ce4c69e5de86750754f3d9d4dddce3d1155eed9",
        "counters": {
            "domain_architectures": 225,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 225
        }
    }
}