"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P69187"	"{'domain_architectures': 941, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pirsf': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 941}"	"['Plays a role in the inhibition of the host NF-kappa-B pathway. This inhibition occurs at the receptor level, by preventing the signaling of TNFR1 as well as IL-1R and TLR3']"	"SH"	""	"SH_MUMP2"	"ae51987f799c2f3f0282c85eeab9a0295ae9e58e"	False	False	False	57	"Small hydrophobic protein"	3	""	"MPLIQPPLYLTFLLLMLLYRIITLYVWSLSTITYKTSVRHASLYQRSFFRWSVDHSL"	"reviewed"	"{'taxId': '11162', 'scientificName': 'Mumps virus (strain Edingburgh 2)', 'fullName': 'Mumps virus (strain Edingburgh 2) (MuV)'}"